PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB0042G10090.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HB-other
Protein Properties Length: 185aa    MW: 20801.3 Da    PI: 4.6408
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB0042G10090.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox69.63.9e-2254104656
                     S--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   6 tftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     ++t eq+ +Le +F+k+ +p +e+reeLAkklg++erqVk+WFqNrR+++k
  OB0042G10090.1  54 CHTCEQVMQLEGVFQKCTHPEEEQREELAKKLGIEERQVKFWFQNRRTRKK 104
                     6789*********************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.46E-1843104IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.2E-2044104IPR009057Homeodomain-like
PROSITE profilePS5007116.87646106IPR001356Homeobox domain
SMARTSM003891.0E-1749110IPR001356Homeobox domain
PfamPF000463.3E-1954104IPR001356Homeobox domain
CDDcd000863.80E-1858104No hitNo description
PRINTSPR000316.7E-77786IPR000047Helix-turn-helix motif
PROSITE patternPS00027081104IPR017970Homeobox, conserved site
PRINTSPR000316.7E-786102IPR000047Helix-turn-helix motif
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 185 aa     Download sequence    Send to blast
MDHGSFQQGS SDAHELDLPL AIMLGAEDGD DGIGDSAVDA HDAGGHAQGK RMKCHTCEQV  60
MQLEGVFQKC THPEEEQREE LAKKLGIEER QVKFWFQNRR TRKKVSDERR EGVVLEDENE  120
ALLAENKALK YAMQDMICFV CSSPVVVPAE ETVQQRYLRF LNKRLADELQ EATAVLNQIA  180
KDADA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLJ3KU651e-136J3KU65_ORYBR; Uncharacterized protein
STRINGOB0042G10090.11e-135(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP149301619
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.11e-26HD-ZIP family protein